Structure of PDB 6xir Chain AH

Receptor sequence
>6xirAH (length=120) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
GRVRTKTVKRASKALIERYYPKLTLDFQTNKRLCDEIATIQSKRLRNKIA
GYTTHLMKRIQKGPVRGISFKLQEEERERKDQYVPEVSRSNGVLNVDNQT
SDLVKSLGLKLPLSVINVSA
3D structure
PDB6xir Structural impact of K63 ubiquitin on yeast translocating ribosomes under oxidative stress.
ChainAH
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna AH G2 R3 V4 R5 T6 K7 S43 K44 R45 R47 K49 T55 H56 M58 R60 K63 R67 G1 R2 V3 R4 T5 K6 S42 K43 R44 R46 K48 T54 H55 M57 R59 K62 R66
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6xir, PDBe:6xir, PDBj:6xir
PDBsum6xir
PubMed32855298
UniProtP14127|RS17B_YEAST Small ribosomal subunit protein eS17B (Gene Name=RPS17B)

[Back to BioLiP]