Structure of PDB 4woi Chain AH

Receptor sequence
>4woiAH (length=129) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
SMQDPIADMLTRIRNGQAANKAAVTMPSSKLKVAIANVLKEEGFIEDFKV
EGDTKPELELTLKYFQGKAVVESIQRVSRPGLRIYKRKDELPKVMAGLGI
AVVSTSKGVMTDRAARQAGLGGEIICYVA
3D structure
PDB4woi Chemically related 4,5-linked aminoglycoside antibiotics drive subunit rotation in opposite directions.
ChainAH
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna AH S2 M3 Q4 D9 T12 R13 R15 N16 K22 S30 K31 L32 K56 Q76 R80 P81 R84 Y86 R88 K89 S105 T106 S107 K108 G109 L121 G122 E124 S1 M2 Q3 D8 T11 R12 R14 N15 K21 S29 K30 L31 K55 Q75 R79 P80 R83 Y85 R87 K88 S104 T105 S106 K107 G108 L120 G121 E123
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0006417 regulation of translation
GO:0043488 regulation of mRNA stability
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4woi, PDBe:4woi, PDBj:4woi
PDBsum4woi
PubMed26224058
UniProtP0A7W7|RS8_ECOLI Small ribosomal subunit protein uS8 (Gene Name=rpsH)

[Back to BioLiP]