Structure of PDB 4v9s Chain AH

Receptor sequence

>4v9sAH (length=137) Species: 300852 (Thermus thermophilus HB8)

LTDPIADMLTRIRNATRVYKESTDVPASRFKEEILRILAREGFIKGYERV
DVDGKPYLRVYLKYGPRRQGPDPRPEQVIHHIRRISKPGRRVYVGVKEIP
RVRRGLGIAILSTSKGVLTDREARKLGVGGELICEVW

3D structure

• PDB: 4v9s The antibiotics dityromycin and GE82832 bind protein S12 and block EF-G-catalyzed translocation.
• Chain: AH
• Resolution: 3.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AH	L2 T3 D8 T11 R12 R14 N15 V19 K21 S29 F31 K56 R75 K88 P89 G90 R91 R92 Y94 G96 V97 R105 S113 T114 S115 G128 V129 G130 E132	L1 T2 D7 T10 R11 R13 N14 V18 K20 S28 F30 K55 R74 K87 P88 G89 R90 R91 Y93 G95 V96 R104 S112 T113 S114 G127 V128 G129 E131

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Mon Nov 25 01:58:41 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4v9s', asym_id = 'AH', title = 'The antibiotics dityromycin and GE82832 bind protein S12 and block EF-G-catalyzed translocation.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4v9s', asym_id='AH', title='The antibiotics dityromycin and GE82832 bind protein S12 and block EF-G-catalyzed translocation.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '4v9s', asym_id = 'AH'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='4v9s', asym_id='AH')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>