Structure of PDB 4v9m Chain AH

Receptor sequence
>4v9mAH (length=138) Species: 262724 (Thermus thermophilus HB27) [Search protein sequence]
MLTDPIADMLTRIRNATRVYKESTDVPASRFKEEILRILAREGFIKGYER
VDVDGKPYLRVYLKYGPRRQGPDPRPEQVIHHIRRISKPGRRVYVGVKEI
PRVRRGLGIAILSTSKGVLTDREARKLGVGGELICEVW
3D structure
PDB4v9m Crystal structures of EF-G-ribosome complexes trapped in intermediate states of translocation.
ChainAH
Resolution4.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna AH M1 T3 D8 T11 R12 R14 N15 K21 A28 S29 R30 F31 K56 K88 P89 R91 R92 Y94 V95 G96 V97 S113 T114 S115 K116 G117 G128 V129 G130 M1 T3 D8 T11 R12 R14 N15 K21 A28 S29 R30 F31 K56 K88 P89 R91 R92 Y94 V95 G96 V97 S113 T114 S115 K116 G117 G128 V129 G130
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4v9m, PDBe:4v9m, PDBj:4v9m
PDBsum4v9m
PubMed23812722
UniProtP62668|RS8_THET2 Small ribosomal subunit protein uS8 (Gene Name=rpsH)

[Back to BioLiP]