Structure of PDB 4v8d Chain AH

Receptor sequence
>4v8dAH (length=151) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLA
VQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGA
VPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
E
3D structure
PDB4v8d A new understanding of the decoding principle on the ribosome.
ChainAH
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna AH R14 T16 A17 M19 A21 G22 R24 R25 K47 K57 A86 A94 A95 T98 I101 A102 L119 T120 K121 E122 S125 R126 N127 N130 R10 T12 A13 M15 A17 G18 R20 R21 K43 K53 A82 A90 A91 T94 I97 A98 L115 T116 K117 E118 S121 R122 N123 N126
BS02 rna AH R15 F26 R11 F22
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v8d, PDBe:4v8d, PDBj:4v8d
PDBsum4v8d
PubMed22437501
UniProtQ5SHQ5|RS5_THET8 Small ribosomal subunit protein uS5 (Gene Name=rpsE)

[Back to BioLiP]