Structure of PDB 4v6u Chain AH

Receptor sequence

>4v6uAH (length=215) Species: 186497 (Pyrococcus furiosus DSM 3638) [Search protein sequence]

MAKPLNERFFIPHEIKVMGRWSTEDVEVRDPSLKPYINLEPRLLPHTHGR
HAKKHFGKANVHIVERLINKIMRSGGSHYKVAGHFMRREHRSLNSKKVKA
YEVVKEAFKIIEQRTGKNPIQVLVWAIENAAPREDTTSVMFGGIRYHVAV
DISPMRRLDVALRNIALGASAKCYRNKMSFAEALAEEIILAANKDPKSYA
YSKKLEIERIAESSR

3D structure

PDB

4v6u Promiscuous behaviour of archaeal ribosomal proteins: Implications for eukaryotic ribosome evolution.

Chain

Resolution

6.6 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AH	S138 E206 I210	S138 E206 I210
BS02	rna	AH	M1 H46 H48 A52 H55 E65 R66 N69 R73 S74 G75 G76 S77 H78 Y79 K80 V81 A82 G83 F85 M86 R88 H90 R91 S92 N94 S95 K96 K97 V98 K99 D159 R163 C173 R175 S179 F180	M1 H46 H48 A52 H55 E65 R66 N69 R73 S74 G75 G76 S77 H78 Y79 K80 V81 A82 G83 F85 M86 R88 H90 R91 S92 N94 S95 K96 K97 V98 K99 D159 R163 C173 R175 S179 F180

Gene Ontology

	Molecular Function
GO:0003729	mRNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0000028	ribosomal small subunit assembly
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0015935	small ribosomal subunit
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4v6u, PDBe:4v6u, PDBj:4v6u
PDBsum	4v6u
PubMed	23222135
UniProt	Q8U0M8\|RS7_PYRFU Small ribosomal subunit protein uS7 (Gene Name=rps7)

[Back to BioLiP]