Structure of PDB 4v66 Chain AH

Receptor sequence
>4v66AH (length=88) Species: 562 (Escherichia coli) [Search protein sequence]
SLSTEATAKIVSEFGRDANDTGSTEVQVALLTAQINHLQGHFAEHKKDHH
SRRGLLRMVSQRRKLLDYLKRKDVARYTRLIERLGLRR
3D structure
PDB4v66 The Structure of the E. coli Ribosome Before and After Accommodation: Implications for Proofreading
ChainAH
Resolution9.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna AH S23 Q34 H45 K47 H50 S51 R53 Q61 R63 K64 Y68 R71 K72 R76 S23 Q34 H45 K47 H50 S51 R53 Q61 R63 K64 Y68 R71 K72 R76
BS02 rna AH L56 V59 R88 L56 V59 R88
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v66, PDBe:4v66, PDBj:4v66
PDBsum4v66
PubMed
UniProtQ8X9M2|RS15_ECO57 Small ribosomal subunit protein uS15 (Gene Name=rpsO)

[Back to BioLiP]