Structure of PDB 4v63 Chain AH

Receptor sequence
>4v63AH (length=138) Species: 262724 (Thermus thermophilus HB27) [Search protein sequence]
MLTDPIADMLTRIRNATRVYKESTDVPASRFKEEILRILAREGFIKGYER
VDVDGKPYLRVYLKYGPRRQGPDPRPEQVIHHIRRISKPGRRVYVGVKEI
PRVRRGLGIAILSTSKGVLTDREARKLGVGGELICEVW
3D structure
PDB4v63 Structural basis for translation termination on the 70S ribosome
ChainAH
Resolution3.207 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna AH M1 L2 T3 P5 T11 R12 R14 N15 K21 A28 S29 R30 F31 K56 K88 P89 G90 R91 R92 Y94 G96 V97 S113 T114 S115 V129 G130 M1 L2 T3 P5 T11 R12 R14 N15 K21 A28 S29 R30 F31 K56 K88 P89 G90 R91 R92 Y94 G96 V97 S113 T114 S115 V129 G130
BS02 MG AH G47 Y48 G47 Y48
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v63, PDBe:4v63, PDBj:4v63
PDBsum4v63
PubMed18596689
UniProtP62668|RS8_THET2 Small ribosomal subunit protein uS8 (Gene Name=rpsH)

[Back to BioLiP]