Structure of PDB 4v4w Chain AH |
>4v4wAH (length=127) Species: 562 (Escherichia coli) [Search protein sequence] |
MQDPIADMLTRIRNGQAANKAAVTMPSSKLKVAIANVLKEEGFIEDFKVE GDTKPELELTLKYFQGKAVVESIQRVSRPGLRIYKRKDELPKVMAGLGIA VVSTSKGVMTDRAARQAGLGGEIICYV |
|
PDB | 4v4w Elongation arrest by SecM via a cascade of ribosomal RNA rearrangements |
Chain | AH |
Resolution | 15.0 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
AH |
Q3 N15 |
Q2 N14 |
|
|
|
|