Structure of PDB 3jbo Chain AH

Receptor sequence

>3jboAH (length=185) Species: 36329 (Plasmodium falciparum 3D7) [Search protein sequence]

KTIVSTQKVLIPEGVKVAINARKVTVSGKYGTLRRSFRHLPIDIRLNKLK
KYIKVVMWFGVPDSLACIRTVCTHLKNMFTGVTKKFLYKMRLVHAHFPIN
SNIVDNNTRIEIRNYLGEKSVRFVKALPGVVIEKSPNVKDEIYVSGADIE
NVSLTAALIHQSVLCRNKDIRKFLDGIYVSEVTTV

3D structure

PDB

3jbo Dynamical features of the Plasmodium falciparum ribosome during translation.

Chain

Resolution

5.8 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AH	K2 T7 K9 N21 R23 R39 H40 P42 D44 R46 K51 K55 M58 W59 A67 R70 T71 T74 H75 Y89 F98 K120 S154 Q162 C166 R167 N168 K169 D170 R172 K173	K1 T6 K8 N20 R22 R38 H39 P41 D43 R45 K50 K54 M57 W58 A66 R69 T70 T73 H74 Y88 F97 K119 S153 Q161 C165 R166 N167 K168 D169 R171 K172

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:3jbo, PDBe:3jbo, PDBj:3jbo
PDBsum	3jbo
PubMed	26432834
UniProt	Q8IE85

[Back to BioLiP]