Structure of PDB 1vy6 Chain AH

Receptor sequence
>1vy6AH (length=137) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
LTDPIADMLTRIRNATRVYKESTDVPASRFKEEILRILAREGFIKGYERV
DVDGKPYLRVYLKYGPRRQGPDPRPEQVIHHIRRISKPGRRVYVGVKEIP
RVRRGLGIAILSTSKGVLTDREARKLGVGGELICEVW
3D structure
PDB1vy6 A proton wire to couple aminoacyl-tRNA accommodation and peptide-bond formation on the ribosome.
ChainAH
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna AH L2 T3 P5 A7 D8 T11 R12 R14 N15 A28 S29 F31 K56 K88 P89 G90 R91 R92 Y94 G96 V97 R105 S113 T114 S115 G128 V129 G130 E132 L1 T2 P4 A6 D7 T10 R11 R13 N14 A27 S28 F30 K55 K87 P88 G89 R90 R91 Y93 G95 V96 R104 S112 T113 S114 G127 V128 G129 E131
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Thu Nov 28 19:44:05 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '1vy6', asym_id = 'AH', title = 'A proton wire to couple aminoacyl-tRNA accommodation and peptide-bond formation on the ribosome.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='1vy6', asym_id='AH', title='A proton wire to couple aminoacyl-tRNA accommodation and peptide-bond formation on the ribosome.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '1vy6', asym_id = 'AH'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='1vy6', asym_id='AH')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>