Structure of PDB 8q5i Chain AG

Receptor sequence

>8q5iAG (length=106) Species: 5476 (Candida albicans) [Search protein sequence]

AESHRLYVKGKHISYQRSKSVTNPNVSLIQIEGVASPKDAKFYLGKRIAY
VYRAPKEIRGSKIRVIWGKVTRTHGNNGLVRANFKKNLPPKTFGASVRIM
LYPSNI

3D structure

PDB

8q5i Structural characterization of cephaeline binding to the eukaryotic ribosome using Cryo-Electron Microscopy

Chain

Resolution

2.45 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AG	A2 E3 S4 H5 R6 Y8 K10 Q17 R18 S19 K20 S21 K39 K42 L45 G46 Y53 R54 P56 K57 S62 K63 I64 R65 V66 W68 K70 T72 R73 H75 G76 N77 N78 R82 K86 K87 N88 P90 P91 K92 A96 S97 R99 N106	A1 E2 S3 H4 R5 Y7 K9 Q16 R17 S18 K19 S20 K38 K41 L44 G45 Y52 R53 P55 K56 S61 K62 I63 R64 V65 W67 K69 T71 R72 H74 G75 N76 N77 R81 K85 K86 N87 P89 P90 K91 A95 S96 R98 N105

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation
GO:0042273	ribosomal large subunit biogenesis

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links