Structure of PDB 8ova Chain AG

Receptor sequence

>8ovaAG (length=150) Species: 5702 (Trypanosoma brucei brucei) [Search protein sequence]

VRMHGNGHGKAASALPYRRTPPTWLKSSSRDVIDAVCKLAKKGLSPSRIG
MQLRDSMGIAQVKNVTGRKILRILKHKGMAPEIPEDLYCLIKRATQMRKH
LERNTKDKDTKFRLILVESRIHRLARYYRRVKQLPPTWKYESSTASAMVA

3D structure

PDB

8ova A single pseudouridine on rRNA regulates ribosome structure and function in the mammalian parasite Trypanosoma brucei.

Chain

Resolution

2.47 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	AG	H123 K140	H122 K139
BS02	rna	AG	R3 M4 H5 H9 G10 K11 A12 S14 P17 R20 G51 M52 R55 A61 G68 R69 L72 R73 H77 C90 H101 N105 K107 D108 K109 D110 F113 R114 L117 R121 R124 Y128 V132 Q134	R2 M3 H4 H8 G9 K10 A11 S13 P16 R19 G50 M51 R54 A60 G67 R68 L71 R72 H76 C89 H100 N104 K106 D107 K108 D109 F112 R113 L116 R120 R123 Y127 V131 Q133
BS03	rna	AG	W139 K140 E142 T145	W138 K139 E141 T144

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0070181	small ribosomal subunit rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005730	nucleolus
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:0035869	ciliary transition zone
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8ova, PDBe:8ova, PDBj:8ova
PDBsum	8ova
PubMed	37985661
UniProt	Q586C2

[Back to BioLiP]