Structure of PDB 8any Chain AG

Receptor sequence

>8anyAG (length=327) Species: 9606 (Homo sapiens)

AFVIPKKNVPTSKRETYTEDFIKKQIEEFNIGKRHLANMMGEDPETFTQE
DIDRAIAYLFPSGLFEKRARPVMKHPEQIFPRQRAIQWGEDGRPFHYLFY
TGKQSYYSLMHDVYGMLLNLEKHQVIGSRWLIKEELEEMLVEKLSDLDYM
QFIRLLEKLLTSQCGAAEEEFVQRFRRSVTLESKKQLIEPVQYDEQGMAF
SKSEGKRKTAKAEAIVYKHGSGRIKVNGIDYQLYFPITQDREQLMFPFHF
VDRLGKHDVTCTVSGGGRSAQAGAIRLAMAKALCSFVTEDEVEWMRQAGL
LTTDPRVRERKKPGQEGARRKFTWKKR

3D structure

• PDB: 8any Structural basis of LRPPRC-SLIRP-dependent translation by the mitoribosome
• Chain: AG
• Resolution: 2.85 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AG	F117 E118 L216 D217 Q220 R276 K277 T278 I306 G336 S338 A339 R375 V376 R377 E378 R379 K380 K381 P382 G383 A387 R388 R389 K390 T392 W393 K394 K395 R396	F65 E66 L147 D148 Q151 R207 K208 T209 I237 G267 S269 A270 R306 V307 R308 E309 R310 K311 K312 P313 G314 A318 R319 R320 K321 T323 W324 K325 K326 R327
BS02	rna	AG	K395 R396	K326 R327
BS03	rna	AG	F54 V55 P57	F2 V3 P5

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0005515 protein binding

Biological Process

• GO:0006412 translation
• GO:0032543 mitochondrial translation

Cellular Component

• GO:0005730 nucleolus
• GO:0005739 mitochondrion
• GO:0005743 mitochondrial inner membrane
• GO:0005763 mitochondrial small ribosomal subunit
• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8any, PDBe:8any, PDBj:8any
• PDBsum: 8any
• PubMed: 39134711
• UniProt: P82933|RT09_HUMAN Small ribosomal subunit protein uS9m (Gene Name=MRPS9)