Structure of PDB 7wfd Chain AG

Receptor sequence
>7wfdAG (length=98) Species: 3702 (Arabidopsis thaliana) [Search protein sequence]
LSPSIVISLSTGLSLFLGRFVFFNFQRENVAKQGLPEQNGKTHFEAGDDR
AKEYVSLLKSNDPIGFNIVDVLAWGSIGHIVAYYILATSSNGYDPSFF
3D structure
PDB7wfd Supramolecular assembly of chloroplast NADH dehydrogenase-like complex with photosystem I from Arabidopsis thaliana.
ChainAG
Resolution3.25 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA AG A148 N152 A87 N91
BS02 CLA AG F83 F86 Q87 V91 Q94 F22 F25 Q26 V30 Q33
BS03 CLA AG Q94 Y145 Q33 Y84
BS04 CLA AG Y145 T149 Y154 F158 Y84 T88 Y93 F97
BS05 CLA AG S65 I68 H140 Y144 S4 I7 H79 Y83
BS06 CLA AG L76 R80 S121 N122 D123 I129 V132 L15 R19 S60 N61 D62 I68 V71
Gene Ontology
Molecular Function
GO:0005515 protein binding
Biological Process
GO:0009773 photosynthetic electron transport in photosystem I
GO:0009780 photosynthetic NADP+ reduction
GO:0015979 photosynthesis
GO:0042550 photosystem I stabilization
GO:0050821 protein stabilization
Cellular Component
GO:0005634 nucleus
GO:0009507 chloroplast
GO:0009522 photosystem I
GO:0009534 chloroplast thylakoid
GO:0009535 chloroplast thylakoid membrane
GO:0009579 thylakoid
GO:0009941 chloroplast envelope
GO:0016020 membrane
GO:0030093 chloroplast photosystem I
GO:0031969 chloroplast membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7wfd, PDBe:7wfd, PDBj:7wfd
PDBsum7wfd
PubMed35123031
UniProtQ9S7N7|PSAG_ARATH Photosystem I reaction center subunit V, chloroplastic (Gene Name=PSAG)

[Back to BioLiP]