Structure of PDB 7q0f Chain AG

Receptor sequence

>7q0fAG (length=106) Species: 237561 (Candida albicans SC5314)

AESHRLYVKGKHISYQRSKSVTNPNVSLIQIEGVASPKDAKFYLGKRIAY
VYRAPKEIRGSKIRVIWGKVTRTHGNNGLVRANFKKNLPPKTFGASVRIM
LYPSNI

3D structure

• PDB: 7q0f E-site drug specificity of the human pathogen Candida albicans ribosome.
• Chain: AG
• Resolution: 2.64 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AG	A2 E3 S4 H5 R6 Y8 K10 Q17 R18 S19 K20 S21 K42 L45 G46 Y53 R54 P56 K57 R60 S62 K63 I64 R65 V66 K70 T72 R73 H75 G76 N77 N78 R82 K87 N88 P90 P91 K92 A96 S97 R99	A1 E2 S3 H4 R5 Y7 K9 Q16 R17 S18 K19 S20 K41 L44 G45 Y52 R53 P55 K56 R59 S61 K62 I63 R64 V65 K69 T71 R72 H74 G75 N76 N77 R81 K86 N87 P89 P90 K91 A95 S96 R98

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation
• GO:0042273 ribosomal large subunit biogenesis

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7q0f, PDBe:7q0f, PDBj:7q0f
• PDBsum: 7q0f
• PubMed: 35613268
• UniProt: A0A1D8PHH4|RL33A_CANAL Large ribosomal subunit protein eL33 (Gene Name=RPL33A)