Structure of PDB 7nsj Chain AG

Receptor sequence

>7nsjAG (length=208) Species: 9823 (Sus scrofa)

SRYGPEYKDPQIDKEYYRKPLAEQTEEEKYERDFKKTQLIKAAPATKTSS
VFEDPVISKFTNMMMKGGNKVLARSLMTQTLEAVKRKQFAKYHAASAEEQ
ATIERNPYTIFHQALKNCEPVIGLVPILKGGHFYQVPVPLADRRRRFLAM
KWMIAECREKKHRRVLMPEKLSQELLEAFHNQGPVIKRKHDMHKMAEANR
ALAHYRWW

3D structure

• PDB: 7nsj Structural basis of translation termination, rescue, and recycling in mammalian mitochondria.
• Chain: AG
• Resolution: 3.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AG	S35 R36 K93 N96 M98 M99 K100 G101 G102 V105 L106 L110 V159 P160 G164 Y168 R177 R178 F181 K185 R192 K195 R197 R198 L200 M201 W241	S1 R2 K59 N62 M64 M65 K66 G67 G68 V71 L72 L76 V125 P126 G130 Y134 R143 R144 F147 K151 R158 K161 R163 R164 L166 M167 W207

Gene Ontology

Molecular Function

• GO:0003729 mRNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0000028 ribosomal small subunit assembly
• GO:0006412 translation

Cellular Component

• GO:0005763 mitochondrial small ribosomal subunit
• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7nsj, PDBe:7nsj, PDBj:7nsj
• PDBsum: 7nsj
• PubMed: 33878294
• UniProt: A0A286ZJ25