Structure of PDB 6zm5 Chain AG

Receptor sequence

>6zm5AG (length=312) Species: 9606 (Homo sapiens)

TYTEDFIKKQIEEFNIGKRHLANMMGEDPETFTQEDIDRAIAYLFPSGLF
EKRARPVMKHPEQIFPRQRAIQWGEDGRPFHYLFYTGKQSYYSLMHDVYG
MLLNLEKHQVIGSRWLIKEELEEMLVEKLSDLDYMQFIRLLEKLLTSQCG
AAEEEFVQRFRRSVTLESKKQLIEPVQYDEQGMAFSKSEGKRKTAKAEAI
VYKHGSGRIKVNGIDYQLYFPITQDREQLMFPFHFVDRLGKHDVTCTVSG
GGRSAQAGAIRLAMAKALCSFVTEDEVEWMRQAGLLTTDPRVRERKKPGQ
EGARRKFTWKKR

3D structure

• PDB: 6zm5 Mechanism of membrane-tethered mitochondrial protein synthesis.
• Chain: AG
• Resolution: 2.89 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AG	F117 E118 L216 D217 R276 K277 I306 G336 S338 A339 R375 V376 R377 E378 R379 K380 K381 P382 R388 R389 K390 T392 W393 K394 K395 R396	F50 E51 L132 D133 R192 K193 I222 G252 S254 A255 R291 V292 R293 E294 R295 K296 K297 P298 R304 R305 K306 T308 W309 K310 K311 R312

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0005515 protein binding

Biological Process

• GO:0006412 translation
• GO:0032543 mitochondrial translation

Cellular Component

• GO:0005730 nucleolus
• GO:0005739 mitochondrion
• GO:0005743 mitochondrial inner membrane
• GO:0005763 mitochondrial small ribosomal subunit
• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6zm5, PDBe:6zm5, PDBj:6zm5
• PDBsum: 6zm5
• PubMed: 33602856
• UniProt: P82933|RT09_HUMAN Small ribosomal subunit protein uS9m (Gene Name=MRPS9)