Structure of PDB 6z1p Chain AG

Receptor sequence
>6z1pAG (length=38) Species: 312017 (Tetrahymena thermophila SB210) [Search protein sequence]
MKIKSALKKYCQHCYIVKRGKKVMIKCKIDPRHKQRQG
3D structure
PDB6z1p Ciliate mitoribosome illuminates evolutionary steps of mitochondrial translation.
ChainAG
Resolution3.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna AG M1 K2 I3 K4 S5 A6 K8 Y10 I16 K18 R19 G20 K21 K22 K28 P31 R32 Q37 G38 M1 K2 I3 K4 S5 A6 K8 Y10 I16 K18 R19 G20 K21 K22 K28 P31 R32 Q37 G38
BS02 ZN AG C27 H33 C27 H33
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6z1p, PDBe:6z1p, PDBj:6z1p
PDBsum6z1p
PubMed32553108
UniProtW7XH61

[Back to BioLiP]