Structure of PDB 6uz7 Chain AG

Receptor sequence

>6uz7AG (length=233) Species: 28985 (Kluyveromyces lactis) [Search protein sequence]

NPLTKSSPRNFGIGQAIQPKRNLSRYVKWPEYVRLQRQKKILSIRLKVPP
SIAQFQNTLDRNTAAETFKLLKKYSPETAAEKKERLTKEAAAIAEGKTKQ
EASPKPYVVKYGLNHVVSLIENKKAKLVLIANDVDPIELVIFLPALCKKM
GVPYAIVKGKARLGTLVNQKTSAVAALTEVREEDEAALAKLVSTINANYL
EKYEDSKKHWGGGIMGQKAQKKIEKRAKAAESA

3D structure

PDB

6uz7 Long-range interdomain communications in eIF5B regulate GTP hydrolysis and translation initiation.

Chain

Resolution

3.6 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AG	S29 R31 N32 I35 G36 Q37 R43 L45 S46 R47 Y48 E53 Y54 R59 R67 L68 E99 K104 R107 Q122 S125 P126 K127 P128 Y133 G134 L135 N136 H137 S140 L161 K182 K192 T193 S194 G238 Q239 K240 A241 K243	S7 R9 N10 I13 G14 Q15 R21 L23 S24 R25 Y26 E31 Y32 R37 R45 L46 E77 K82 R85 Q100 S103 P104 K105 P106 Y111 G112 L113 N114 H115 S118 L139 K160 K170 T171 S172 G216 Q217 K218 A219 K221
BS02	rna	AG	Y54 Q58 R59 K62 K180 R184	Y32 Q36 R37 K40 K158 R162

Gene Ontology

	Molecular Function
GO:0003723	RNA binding

	Biological Process
GO:0000470	maturation of LSU-rRNA
GO:0042254	ribosome biogenesis

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6uz7, PDBe:6uz7, PDBj:6uz7
PDBsum	6uz7
PubMed	31900355
UniProt	B4UN96

[Back to BioLiP]