Structure of PDB 5a9z Chain AG

Receptor sequence

>5a9zAG (length=182) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]

MPLDVALKRKYYEEVRPELIRRFGYQNVWEVPRLEKVVINQGLGEAKEDA
RILEKAAQELALITGQKPAVTRAKKSISNFKLRKGMPIGLRVTLRRDRMW
IFLEKLLNVALPRIRDFRGLNPNSFDGRGNYNLGLREQLIFPEITYDMVD
ALRGMDIAVVTTAETDEEARALLELLGFPFRK

3D structure

PDB

5a9z Structure of Bipa in GTP Form Bound to the Ratcheted Ribosome.

Chain

Resolution

4.7 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AG	V38 N40 Q41 G42 L43 E45 A46 F80 R83 M86 I88 R91 D126 R128 N130 Y131 N132 L135 R136 R153 G154 M155 D156	V38 N40 Q41 G42 L43 E45 A46 F80 R83 M86 I88 R91 D126 R128 N130 Y131 N132 L135 R136 R153 G154 M155 D156
BS02	rna	AG	N27 W29 Q66 T93 L94 R95 R96 R98	N27 W29 Q66 T93 L94 R95 R96 R98

Gene Ontology

	Molecular Function
GO:0000049	tRNA binding
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5a9z, PDBe:5a9z, PDBj:5a9z
PDBsum	5a9z
PubMed	26283392
UniProt	Q5SHQ0\|RL5_THET8 Large ribosomal subunit protein uL5 (Gene Name=rplE)

[Back to BioLiP]