Structure of PDB 4wqf Chain AG

Receptor sequence

>4wqfAG (length=181) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]

PLDVALKRKYYEEVRPELIRRFGYQNVWEVPRLEKVVINQGLGEAKEDAR
ILEKAAQELALITGQKPAVTRAKKSISNFKLRKGMPIGLRVTLRRDRMWI
FLEKLLNVALPRIRDFRGLNPNSFDGRGNYNLGLREQLIFPEITYDMVDA
LRGMDIAVVTTAETDEEARALLELLGFPFRK

3D structure

PDB

4wqf Conformational Changes of Elongation Factor G on the Ribosome during tRNA Translocation.

Chain

Resolution

2.8 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	AG	K36 N40 G42 L43 T71 K74 K75 F80 I88 S124 D126 R128 N132 G134 L135 R136 G154 M155 D156	K35 N39 G41 L42 T70 K73 K74 F79 I87 S123 D125 R127 N131 G133 L134 R135 G153 M154 D155
BS02	rna	AG	P2 N27 W29 E30 Q66 K67 V70 R72 R91 V92 T93 R95 R96 R98	P1 N26 W28 E29 Q65 K66 V69 R71 R90 V91 T92 R94 R95 R97
BS03	rna	AG	S76 S78	S75 S77
BS04	MG	AG	R128 N130 T161 A163	R127 N129 T160 A162

Gene Ontology

	Molecular Function
GO:0000049	tRNA binding
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4wqf, PDBe:4wqf, PDBj:4wqf
PDBsum	4wqf
PubMed	25594181
UniProt	Q5SHQ0\|RL5_THET8 Large ribosomal subunit protein uL5 (Gene Name=rplE)

[Back to BioLiP]