Structure of PDB 4v7k Chain AG

Receptor sequence

>4v7kAG (length=181) Species: 300852 (Thermus thermophilus HB8)

PLDVALKRKYYEEVRPELIRRFGYQNVWEVPRLEKVVINQGLGEAKEDAR
ILEKAAQELALITGQKPAVTRAKKSISNFKLRKGMPIGLRVTLRRDRMWI
FLEKLLNVALPRIRDFRGLNPNSFDGRGNYNLGLREQLIFPEITYDMVDA
LRGMDIAVVTTAETDEEARALLELLGFPFRK

3D structure

• PDB: 4v7k The structural basis for mRNA recognition and cleavage by the ribosome-dependent endonuclease RelE.
• Chain: AG
• Resolution: 3.6 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AG	S78 R83	S77 R82
BS02	rna	AG	N40 L43 T71 R72 A73 K74 N79 R91 S124 F125 R128 N132 L133 G134 L135 R136 G154 M155 D156	N39 L42 T70 R71 A72 K73 N78 R90 S123 F124 R127 N131 L132 G133 L134 R135 G153 M154 D155
BS03	rna	AG	L3 N27 W29 E30 Q66 K67 P68 A69 V70 T71 R72 V92 T93 R95	L2 N26 W28 E29 Q65 K66 P67 A68 V69 T70 R71 V91 T92 R94

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v7k, PDBe:4v7k, PDBj:4v7k
• PDBsum: 4v7k
• PubMed: 20005802
• UniProt: Q5SHQ0|RL5_THET8 Large ribosomal subunit protein uL5 (Gene Name=rplE)