Structure of PDB 4v79 Chain AG

Receptor sequence
>4v79AG (length=150) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
RRRVIGQRKILPDPKFGSELLAKFVNILMVDGKKSTAESIVYSALETLAQ
RSGKSELEAFEVALENVRPTVEVKSRRVGGSTYQVPVEVRPVRRNALAMR
WIVEAARKRGDKSMALRLANELSDAAENKGTAVKKREDVHRMAEANKAFA
3D structure
PDB4v79 Energy barriers and driving forces in tRNA translocation through the ribosome.
ChainAG
Resolution15.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna AG R2 R3 L29 V31 V74 K75 S76 R78 R101 R108 D112 K113 K136 R1 R2 L28 V30 V73 K74 S75 R77 R100 R107 D111 K112 K135
BS02 rna AG G81 S82 T83 Y84 E145 A146 A149 F150 G80 S81 T82 Y83 E144 A145 A148 F149
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0015935 small ribosomal subunit

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v79, PDBe:4v79, PDBj:4v79
PDBsum4v79
PubMed24186064
UniProtP02359|RS7_ECOLI Small ribosomal subunit protein uS7 (Gene Name=rpsG)

[Back to BioLiP]