Structure of PDB 4v73 Chain AG

Receptor sequence

>4v73AG (length=150) Species: 83333 (Escherichia coli K-12) [Search protein sequence]

RRRVIGQRKILPDPKFGSELLAKFVNILMVDGKKSTAESIVYSALETLAQ
RSGKSELEAFEVALENVRPTVEVKSRRVGGSTYQVPVEVRPVRRNALAMR
WIVEAARKRGDKSMALRLANELSDAAENKGTAVKKREDVHRMAEANKAFA

3D structure

PDB

4v73 Energy barriers and driving forces in tRNA translocation through the ribosome.

Chain

Resolution

15.0 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AG	R2 R3 R4 V5 R9 K24 N27 L29 M30 V31 D32 G33 K34 K35 S36 T37 R78 V79 G80 R91 R94 R101 R108 K109 K113 S114 M115 K136	R1 R2 R3 V4 R8 K23 N26 L28 M29 V30 D31 G32 K33 K34 S35 T36 R77 V78 G79 R90 R93 R100 R107 K108 K112 S113 M114 K135
BS02	rna	AG	R52 K130 R142	R51 K129 R141

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0015935	small ribosomal subunit

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4v73, PDBe:4v73, PDBj:4v73
PDBsum	4v73
PubMed	24186064
UniProt	P02359\|RS7_ECOLI Small ribosomal subunit protein uS7 (Gene Name=rpsG)

[Back to BioLiP]