Structure of PDB 4v71 Chain AG

Receptor sequence
>4v71AG (length=150) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
RRRVIGQRKILPDPKFGSELLAKFVNILMVDGKKSTAESIVYSALETLAQ
RSGKSELEAFEVALENVRPTVEVKSRRVGGSTYQVPVEVRPVRRNALAMR
WIVEAARKRGDKSMALRLANELSDAAENKGTAVKKREDVHRMAEANKAFA
3D structure
PDB4v71 Energy barriers and driving forces in tRNA translocation through the ribosome.
ChainAG
Resolution20.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna AG R2 R4 I6 Q8 R9 K24 N27 L29 V31 D32 G33 K34 S36 T37 K75 R77 R78 S82 V88 R91 R94 R101 K113 M115 R1 R3 I5 Q7 R8 K23 N26 L28 V30 D31 G32 K33 S35 T36 K74 R76 R77 S81 V87 R90 R93 R100 K112 M114
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0015935 small ribosomal subunit

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v71, PDBe:4v71, PDBj:4v71
PDBsum4v71
PubMed24186064
UniProtP02359|RS7_ECOLI Small ribosomal subunit protein uS7 (Gene Name=rpsG)

[Back to BioLiP]