Structure of PDB 4v6u Chain AG

Receptor sequence

>4v6uAG (length=125) Species: 186497 (Pyrococcus furiosus DSM 3638)

MATFKLVISDPKSGIAKQVEITGAETEKLIGKRIGDQIPAKELNINLNEL
FGKEFPEDVKLEIRGGTDKDGFPMRPDIHGPRRVRVLLSKGPGFRPKEKG
ERRKKTVRGNTISPEIVQVNVKLVY

3D structure

• PDB: 4v6u Promiscuous behaviour of archaeal ribosomal proteins: Implications for eukaryotic ribosome evolution.
• Chain: AG
• Resolution: 6.6 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AG	K5 V7 S9 A16 K17 Q18 R33 I34 R64 G65 T67 K69 D70 G71 P73 R75 P76 D77 I78 H79 R83 V84 R85 V86 L87 L88 K90 P92 F94 K97 E98 K99 G100 E101 R102 R103 K104 N110 Q118 N120 K122	K5 V7 S9 A16 K17 Q18 R33 I34 R64 G65 T67 K69 D70 G71 P73 R75 P76 D77 I78 H79 R83 V84 R85 V86 L87 L88 K90 P92 F94 K97 E98 K99 G100 E101 R102 R103 K104 N110 Q118 N120 K122

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v6u, PDBe:4v6u, PDBj:4v6u
• PDBsum: 4v6u
• PubMed: 23222135
• UniProt: Q8U3H8|RS6E_PYRFU Small ribosomal subunit protein eS6 (Gene Name=rps6e)