Structure of PDB 4v6l Chain AG

Receptor sequence

>4v6lAG (length=232) Species: 83333 (Escherichia coli K-12)

GQKVHPNGIRLGIVKPWNSTWFANTKEFADNLDSDFKVRQYLTKELAKAS
VSRIVIERPAKSIRVTIHTARPGIVIGKKGEDVEKLRKVVADIAGVPAQI
NIAEVRKPELDAKLVADSITSQLERRVMFRRAMKRAVQNAMRLGAKGIKV
EVSGRLGGAEIARTEWYREGRVPLHTLRADIDYNTSEAHTTYGVIGVKVW
IFKGEILGGMAAVEQPEKPAAQPKKQQRKGRK

3D structure

• PDB: 4v6l Structural insights into cognate versus near-cognate discrimination during decoding.
• Chain: AG
• Resolution: 13.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AG	G1 Q2 K3 V4 I13 N24 T25 K26 E27 S153 R155 R163 W166 R168 G170 R171 V172 P173 L174 H175 T176 L177 R178 E187 H189 T190 T191 Y192 G193 V194 K198 E214 E217 K218 A220 A221 Q222 P223 K224 R228 K229 R231	G1 Q2 K3 V4 I13 N24 T25 K26 E27 S153 R155 R163 W166 R168 G170 R171 V172 P173 L174 H175 T176 L177 R178 E187 H189 T190 T191 Y192 G193 V194 K198 E214 E217 K218 A220 A221 Q222 P223 K224 R228 K229 R231
BS02	rna	AG	Q122 M128 F129 R130 R131 L156 G157 G158 A159 E160 I161 R163	Q122 M128 F129 R130 R131 L156 G157 G158 A159 E160 I161 R163

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0003723 RNA binding
• GO:0003729 mRNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0000028 ribosomal small subunit assembly
• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v6l, PDBe:4v6l, PDBj:4v6l
• PDBsum: 4v6l
• PubMed: 21378755
• UniProt: P0A7V3|RS3_ECOLI Small ribosomal subunit protein uS3 (Gene Name=rpsC)