Structure of PDB 4v66 Chain AG

Receptor sequence
>4v66AG (length=96) Species: 562 (Escherichia coli) [Search protein sequence]
AKQSMKAREVKRVALADKYFAKRAELKAIISDVNDRWNAVLKLQTLPRDS
SPSRQRNRCRQTGRPHGFLRKFGLSRIKVREAAMRGEIPGLKKASW
3D structure
PDB4v66 The Structure of the E. coli Ribosome Before and After Accommodation: Implications for Proofreading
ChainAG
Resolution9.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna AG A1 K2 Q3 S4 R8 L15 K18 R23 N34 R52 R58 R60 N61 P69 G71 F72 L73 R74 K75 R80 I81 R84 K97 S99 A1 K2 Q3 S4 R8 L15 K18 R23 N34 R48 R54 R56 N57 P65 G67 F68 L69 R70 K71 R76 I77 R80 K93 S95
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v66, PDBe:4v66, PDBj:4v66
PDBsum4v66
PubMed
UniProtP0AG59|RS14_ECOLI Small ribosomal subunit protein uS14 (Gene Name=rpsN)

[Back to BioLiP]