Structure of PDB 4v5r Chain AG

Receptor sequence

>4v5rAG (length=155) Species: 300852 (Thermus thermophilus HB8)

ARRRRAEVRQLQPDLVYGDVLVTAFINKIMRDGKKNLAARIFYDACKIIQ
EKTGQEPLKVFKQAVENVKPRMEVRSRRVGGANYQVPMEVSPRRQQSLAL
RWLVQAANQRPERRAAVRIAHELMDAAEGKGGAVKKKEDVERMAEANRAY
AHYRW

3D structure

• PDB: 4v5r How Mutations in tRNA Distant from the Anticodon Affect the Fidelity of Decoding.
• Chain: AG
• Resolution: 3.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AG	A2 R3 R4 A7 R10 N28 K29 I30 M31 R32 D33 G34 K35 K36 N37 L38 R41 I42 R79 R94 R95 S98 R102 N109 R114 A116	A1 R2 R3 A6 R9 N27 K28 I29 M30 R31 D32 G33 K34 K35 N36 L37 R40 I41 R78 R93 R94 S97 R101 N108 R113 A115
BS02	rna	AG	S77 N84 Q86 D140 R143 M144 N148	S76 N83 Q85 D139 R142 M143 N147

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003723 RNA binding
• GO:0003729 mRNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0000028 ribosomal small subunit assembly
• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v5r, PDBe:4v5r, PDBj:4v5r
• PDBsum: 4v5r
• PubMed: 21378964
• UniProt: P17291|RS7_THET8 Small ribosomal subunit protein uS7 (Gene Name=rpsG)