Structure of PDB 4v51 Chain AG

Receptor sequence
>4v51AG (length=155) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
ARRRRAEVRQLQPDLVYGDVLVTAFINKIMRDGKKNLAARIFYDACKIIQ
EKTGQEPLKVFKQAVENVKPRMEVRSRRVGGANYQVPMEVSPRRQQSLAL
RWLVQAANQRPERRAAVRIAHELMDAAEGKGGAVKKKEDVERMAEANRAY
AHYRW
3D structure
PDB4v51 Structure of the 70S ribosome complexed with mRNA and tRNA.
ChainAG
Resolution2.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna AG A2 R3 R4 R6 R10 K29 I30 M31 D33 K35 L38 R41 I42 R76 R78 G82 Y85 R95 S98 R102 N109 R114 A116 R119 A1 R2 R3 R5 R9 K28 I29 M30 D32 K34 L37 R40 I41 R75 R77 G81 Y84 R94 S97 R101 N108 R113 A115 R118
BS02 rna AG S77 R79 N84 Q86 R143 M144 S76 R78 N83 Q85 R142 M143
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v51, PDBe:4v51, PDBj:4v51
PDBsum4v51
PubMed16959973
UniProtP17291|RS7_THET8 Small ribosomal subunit protein uS7 (Gene Name=rpsG)

[Back to BioLiP]