Structure of PDB 4v4r Chain AG

Receptor sequence

>4v4rAG (length=155) Species: 300852 (Thermus thermophilus HB8)

ARRRRAEVRQLQPDLVYGDVLVTAFINKIMRDGKKNLAARIFYDACKIIQ
EKTGQEPLKVFKQAVENVKPRMEVRSRRVGGANYQVPMEVSPRRQQSLAL
RWLVQAANQRPERRAAVRIAHELMDAAEGKGGAVKKKEDVERMAEANRAY
AHYRW

3D structure

• PDB: 4v4r Crystal Structures of the Ribosome in Complex with Release Factors RF1 and RF2 Bound to a Cognate Stop Codon.
• Chain: AG
• Resolution: 5.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AG	R3 R4 R6 A7 R10 L12 N28 K29 I30 M31 R32 D33 G34 K35 K36 N37 L38 R41 I42 Y85 R94 R95 S98 L99 R102 R114 R115 A116 R119	R2 R3 R5 A6 R9 L11 N27 K28 I29 M30 R31 D32 G33 K34 K35 N36 L37 R40 I41 Y84 R93 R94 S97 L98 R101 R113 R114 A115 R118
BS02	rna	AG	R78 R79 A83 N84 Y85 R143 M144 A147 N148	R77 R78 A82 N83 Y84 R142 M143 A146 N147

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003723 RNA binding
• GO:0003729 mRNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0000028 ribosomal small subunit assembly
• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v4r, PDBe:4v4r, PDBj:4v4r
• PDBsum: 4v4r
• PubMed: 16377566
• UniProt: P17291|RS7_THET8 Small ribosomal subunit protein uS7 (Gene Name=rpsG)