Structure of PDB 8q5i Chain AF

Receptor sequence

>8q5iAF (length=125) Species: 5476 (Candida albicans) [Search protein sequence]

ATSVPHPKIVKKYTKKFKRHHSDRYHRVAENWRKQKGIDSCVRRRFRGTI
PQPNIGYGSNKKTKFLNPAGYKVYLVKNVKDLDVLLLHTKSYAAEIASSV
SSRKRVEIVAKAKKLGVKVTNPKGK

3D structure

PDB

8q5i Structural characterization of cephaeline binding to the eukaryotic ribosome using Cryo-Electron Microscopy

Chain

Resolution

2.45 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AF	A2 T3 K12 K13 Y14 T15 K16 K17 F18 R20 H21 H22 D24 R25 Y26 H27 R28 V29 N32 W33 R34 K35 K37 G38 I39 D40 S41 R44 R45 R46 F47 R48 P54 N55 I56 G57 Y58 G59 S60 N61 K62 K63 K65 F66 P69 L76 N79 K81 E96 A98 S99 S100 S102 R104 K105 G117 K119 N122 G125 K126	A1 T2 K11 K12 Y13 T14 K15 K16 F17 R19 H20 H21 D23 R24 Y25 H26 R27 V28 N31 W32 R33 K34 K36 G37 I38 D39 S40 R43 R44 R45 F46 R47 P53 N54 I55 G56 Y57 G58 S59 N60 K61 K62 K64 F65 P68 L75 N78 K80 E95 A97 S98 S99 S101 R103 K104 G116 K118 N121 G124 K125

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:8q5i, PDBe:8q5i, PDBj:8q5i
PDBsum	8q5i
PubMed
UniProt	O94008\|RL32_CANAX Large ribosomal subunit protein eL32 (Gene Name=RPL32)