Structure of PDB 8ova Chain AF

Receptor sequence
>8ovaAF (length=115) Species: 5702 (Trypanosoma brucei brucei) [Search protein sequence]
DSLEDALRIVLMKARETNGLICGLSEVTRALDRRTAHLCVLADDCEDEEY
KKLVTALAKQNNIDLVSMDEREKLAQWAGLTRMAADGSVRKTLKCSCLAV
RDFGRTKALDYLLSQ
3D structure
PDB8ova A single pseudouridine on rRNA regulates ribosome structure and function in the mammalian parasite Trypanosoma brucei.
ChainAF
Resolution2.47 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna AF C48 G49 L50 S51 E52 R55 C71 E72 L106 R108 A111 R116 L119 K120 C121 C22 G23 L24 S25 E26 R29 C45 E46 L80 R82 A85 R90 L93 K94 C95
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
GO:0010608 post-transcriptional regulation of gene expression
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8ova, PDBe:8ova, PDBj:8ova
PDBsum8ova
PubMed37985661
UniProtQ03253|RS12_TRYBB Small ribosomal subunit protein eS12 (Gene Name=RPS12)

[Back to BioLiP]