Structure of PDB 8oeq Chain AF

Receptor sequence

>8oeqAF (length=124) Species: 5476 (Candida albicans) [Search protein sequence]

ATSVPHPKIVKKYTKKFKRHHSDRYHRVAENWRKQKGIDSCVRRRFRGTI
PQPNIGYGSNKKTKFLNPAGYKVYLVKNVKDLDVLLLHTKSYAAEIASSV
SSRKRVEIVAKAKKLGVKVTNPKG

3D structure

PDB

8oeq Drug-induced rotational movement of the ribosome is a key factor for read-through enhancement

Chain

Resolution

3.3 Å

3D
structure

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AF	A2 T3 K12 K13 Y14 T15 F18 R20 H22 D24 R25 Y26 H27 R28 V29 N32 W33 R34 K35 K37 G38 I39 D40 S41 R44 R45 R46 F47 R48 G49 P52 P54 N55 I56 G57 Y58 G59 S60 N61 K62 K63 K65 F66 L67 K78 N79 E96 A98 S99 S100 S102 S103 R104 K105 K119 K124 G125	A1 T2 K11 K12 Y13 T14 F17 R19 H21 D23 R24 Y25 H26 R27 V28 N31 W32 R33 K34 K36 G37 I38 D39 S40 R43 R44 R45 F46 R47 G48 P51 P53 N54 I55 G56 Y57 G58 S59 N60 K61 K62 K64 F65 L66 K77 N78 E95 A97 S98 S99 S101 S102 R103 K104 K118 K123 G124
BS02	MG	AF	I10 K12 L67 N68	I9 K11 L66 N67

External links

PDB	RCSB:8oeq, PDBe:8oeq, PDBj:8oeq
PDBsum	8oeq
PubMed
UniProt	O94008\|RL32_CANAX Large ribosomal subunit protein eL32 (Gene Name=RPL32)