Structure of PDB 8c3a Chain AF

Receptor sequence

>8c3aAF (length=124) Species: 5476 (Candida albicans)

ATSVPHPKIVKKYTKKFKRHHSDRYHRVAENWRKQKGIDSCVRRRFRGTI
PQPNIGYGSNKKTKFLNPAGYKVYLVKNVKDLDVLLLHTKSYAAEIASSV
SSRKRVEIVAKAKKLGVKVTNPKG

3D structure

• PDB: 8c3a New crystal system to promote screening for new eukaryotic inhibitors
• Chain: AF
• Resolution: 3.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AF	A2 T3 K12 K13 Y14 T15 K16 F18 K19 R20 H22 D24 R25 Y26 H27 R28 V29 N32 W33 R34 K35 Q36 K37 G38 I39 D40 S41 C42 R44 R45 R46 F47 R48 G49 P52 P54 N55 I56 G57 Y58 G59 S60 N61 K62 K65 F66 L67 P69 L76 K78 N79 K81 E96 A98 S99 S100 S102 S103 R104 K105 N122 K124 G125	A1 T2 K11 K12 Y13 T14 K15 F17 K18 R19 H21 D23 R24 Y25 H26 R27 V28 N31 W32 R33 K34 Q35 K36 G37 I38 D39 S40 C41 R43 R44 R45 F46 R47 G48 P51 P53 N54 I55 G56 Y57 G58 S59 N60 K61 K64 F65 L66 P68 L75 K77 N78 K80 E95 A97 S98 S99 S101 S102 R103 K104 N121 K123 G124
BS02	MG	AF	Y26 H27 V29	Y25 H26 V28
BS03	MG	AF	I10 K12 L67 N68 P69	I9 K11 L66 N67 P68

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8c3a, PDBe:8c3a, PDBj:8c3a
• PDBsum: 8c3a
• UniProt: O94008|RL32_CANAX Large ribosomal subunit protein eL32 (Gene Name=RPL32)