Structure of PDB 7wfd Chain AF

Receptor sequence

>7wfdAF (length=153) Species: 3702 (Arabidopsis thaliana) [Search protein sequence]

DISGLTPCKDSKQFAKREKQQIKKLESSLKLYAPESAPALALNAQIEKTK
RRFDNYGKYGLLCGSDGLPHLIVNGDQRHWGEFITPGILFLYIAGWIGWV
GRSYLIAISGEKKPAMKEIIIDVPLASRIIFRGFIWPVAAYREFLNGDLI
AKD

3D structure

PDB

7wfd Supramolecular assembly of chloroplast NADH dehydrogenase-like complex with photosystem I from Arabidopsis thaliana.

Chain

Resolution

3.25 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	CLA	AF	G165 G168 Y171 I188	G98 G101 Y104 I121
BS02	CLA	AF	V205 F211 I217	V138 F144 I150
BS03	CLA	AF	F150 G154 F157 L158 A161	F83 G87 F90 L91 A94
BS04	CLA	AF	V140 F150 L158	V73 F83 L91
BS05	CLA	AF	Y171 L172 E185 I188 I197	Y104 L105 E118 I121 I130
BS06	CLA	AF	I160 W163 I164 V167 I197	I93 W96 I97 V100 I130
BS07	CLA	AF	N141 G142 D143 Q144	N74 G75 D76 Q77

Gene Ontology

	Molecular Function
GO:0003729	mRNA binding
GO:0019904	protein domain specific binding

	Biological Process
GO:0015979	photosynthesis

	Cellular Component
GO:0005634	nucleus
GO:0009507	chloroplast
GO:0009522	photosystem I
GO:0009534	chloroplast thylakoid
GO:0009535	chloroplast thylakoid membrane
GO:0009538	photosystem I reaction center
GO:0009579	thylakoid
GO:0009941	chloroplast envelope
GO:0010287	plastoglobule
GO:0016020	membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7wfd, PDBe:7wfd, PDBj:7wfd
PDBsum	7wfd
PubMed	35123031
UniProt	Q9SHE8\|PSAF_ARATH Photosystem I reaction center subunit III, chloroplastic (Gene Name=PSAF)

[Back to BioLiP]