Structure of PDB 7qi5 Chain AF

Receptor sequence

>7qi5AF (length=208) Species: 9606 (Homo sapiens)

SRYSPEFKDPLIDKEYYRKPVEELTEEEKYVRELKKTQLIKAAPAGKTSS
VFEDPVISKFTNMMMIGGNKVLARSLMIQTLEAVKRKQFEKYHAASAEEQ
ATIERNPYTIFHQALKNCEPMIGLVPILKGGRFYQVPVPLPDRRRRFLAM
KWMITECRDKKHQRTLMPEKLSHKLLEAFHNQGPVIKRKHDLHKMAEANR
ALAHYRWW

3D structure

• PDB: 7qi5 Structure of mitoribosome reveals mechanism of mRNA binding, tRNA interactions with L1 stalk, roles of cofactors and rRNA modifications.
• Chain: AF
• Resolution: 2.63 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AF	S35 R36 Y37 S38 K93 N96 M99 I100 G101 G102 K104 V105 L106 L110 R166 R177 R178 F181 K185 R192 R198 T199 L200 M201 W241	S1 R2 Y3 S4 K59 N62 M65 I66 G67 G68 K70 V71 L72 L76 R132 R143 R144 F147 K151 R158 R164 T165 L166 M167 W207
BS02	rna	AF	F167 Q169 K221 D225 K228 M229 A232	F133 Q135 K187 D191 K194 M195 A198
BS03	rna	AF	G164 G165	G130 G131

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003729 mRNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0000028 ribosomal small subunit assembly
• GO:0006412 translation
• GO:0032543 mitochondrial translation

Cellular Component

• GO:0005739 mitochondrion
• GO:0005743 mitochondrial inner membrane
• GO:0005763 mitochondrial small ribosomal subunit
• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7qi5, PDBe:7qi5, PDBj:7qi5
• PDBsum: 7qi5
• PubMed: 38769321
• UniProt: Q9Y2R9|RT07_HUMAN Small ribosomal subunit protein uS7m (Gene Name=MRPS7)