Structure of PDB 6gqv Chain AF

Receptor sequence

>6gqvAF (length=124) Species: 4932 (Saccharomyces cerevisiae)

KKRVFKTHSYRGVDLEKLLEMSTEDFVKLAPARVRRRFARGMTSKPAGFM
KKLRAAKLAAPENEKPAPVRTHMRNMIIVPEMIGSVVGIYNGKAFNQVEI
RPEMLGHYLGEFSITYTPVRHGRA

3D structure

• PDB: 6gqv Structural Insights into the Role of Diphthamide on Elongation Factor 2 in mRNA Reading-Frame Maintenance.
• Chain: AF
• Resolution: 4.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AF	P38 A39 R40 R42 R43 R44 R47 K52 A54 G55 K58 K59 R77 H79 M80 R81 N82 Y97 N98 G99 K100 Y115 G117 S120 T122 Y123 T124 P125 R127 H128 G129	P31 A32 R33 R35 R36 R37 R40 K45 A47 G48 K51 K52 R70 H72 M73 R74 N75 Y90 N91 G92 K93 Y108 G110 S113 T115 Y116 T117 P118 R120 H121 G122

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit

External links

• PDB: RCSB:6gqv, PDBe:6gqv, PDBj:6gqv
• PDBsum: 6gqv
• PubMed: 29886014
• UniProt: Q01855|RS15_YEAST Small ribosomal subunit protein uS19 (Gene Name=RPS15)