Structure of PDB 6fxc Chain AF

Receptor sequence

>6fxcAF (length=175) Species: 273036 (Staphylococcus aureus RF122) [Search protein sequence]

NRLKEKFNTEVTENLMKKFNYSSVMEVPKIDKIVVNMGVGDAVQNSKVLD
NAVEELELITGQKPLVTKAKKSIATFRLREGMPIGAKVTLRGERMYEFLD
KLISVSLPRVRDFQGVSKKAFDGRGNYTLGVKEQLIFPEIDYDKVSKVRG
MDIVIVTTANTDEEARELLANFGMP

3D structure

PDB

6fxc The cryo-EM structure of hibernating 100S ribosome dimer from pathogenic Staphylococcus aureus.

Chain

Resolution

6.76 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AF	K33 V35 N37 M38 G39 V40 T68 I74 F77 I85 K88 A121 F122 D123 R125 T129 G131 V132 K133 R150 G151 M152 D153	K32 V34 N36 M37 G38 V39 T67 I73 F76 I84 K87 A120 F121 D122 R124 T128 G130 V131 K132 R149 G150 M151 D152
BS02	rna	AF	M26 E27 Q63 K64 L66 K69 K88 V89 T90 R92	M25 E26 Q62 K63 L65 K68 K87 V88 T89 R91

Gene Ontology

	Molecular Function
GO:0000049	tRNA binding
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6fxc, PDBe:6fxc, PDBj:6fxc
PDBsum	6fxc
PubMed	28959035
UniProt	Q2YYK9\|RL5_STAAB Large ribosomal subunit protein uL5 (Gene Name=rplE)

[Back to BioLiP]