Structure of PDB 4v7v Chain AF

Receptor sequence

>4v7vAF (length=100) Species: 83333 (Escherichia coli K-12)

MRHYEIVFMVHPDQSEQVPGMIERYTAAITGAEGKIHRLEDWGRRQLAYP
INKLHKAHYVLMNVEAPQEVIDELETTFRFNDAVIRSMVMRTKHAVTEAS

3D structure

• PDB: 4v7v Structures of the Escherichia coli ribosome with antibiotics bound near the peptidyl transferase center explain spectra of drug action.
• Chain: AF
• Resolution: 3.2891 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AF	R2 I51 K53 R86 M88 V89 M90	R2 I51 K53 R86 M88 V89 M90

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome

External links

• PDB: RCSB:4v7v, PDBe:4v7v, PDBj:4v7v
• PDBsum: 4v7v
• PubMed: 20876128
• UniProt: P02358|RS6_ECOLI Small ribosomal subunit protein bS6 (Gene Name=rpsF)