Structure of PDB 4v6l Chain AF

Receptor sequence

>4v6lAF (length=240) Species: 83333 (Escherichia coli K-12) [Search protein sequence]

ATVSMRDMLKAGVHFGHQTRYWNPKMKPFIFGARNKVHIINLEKTVPMFN
EALAELNKIASRKGKILFVGTKRAASEAVKDAALSCDQFFVNHRWLGGML
TNWKTVRQSIKRLKDLETQSQDGTFDKLTKKEALMRTRELEKLENSLGGI
KDMGGLPDALFVIDADHEHIAIKEANNLGIPVFAIVDTNSDPDGVDFVIP
GNDDAIRAVTLYLGAVAATVREGRSQDLASQAEESFVEAE

3D structure

PDB

4v6l Structural insights into cognate versus near-cognate discrimination during decoding.

Chain

Resolution

13.2 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AF	R20 Y21 W22 P24 K27 K36 R94 G97 G98 T101 N102 K104 T105 Q108 S109 R112 K130 K131 L134 M135 R138 K142 I170 K173 E174 N177 D191	R20 Y21 W22 P24 K27 K36 R94 G97 G98 T101 N102 K104 T105 Q108 S109 R112 K130 K131 L134 M135 R138 K142 I170 K173 E174 N177 D191

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding
GO:0008270	zinc ion binding

	Biological Process
GO:0000028	ribosomal small subunit assembly
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0015935	small ribosomal subunit
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4v6l, PDBe:4v6l, PDBj:4v6l
PDBsum	4v6l
PubMed	21378755
UniProt	P0A7V0\|RS2_ECOLI Small ribosomal subunit protein uS2 (Gene Name=rpsB)

[Back to BioLiP]