Structure of PDB 3jbn Chain AF

Receptor sequence

>3jbnAF (length=390) Species: 36329 (Plasmodium falciparum 3D7) [Search protein sequence]

PVANVYSTNGKNVVGEVEIPVVFQTPIRNDLIQSVYTNMSKNRRHPYAVK
LGAGYETSAESWGTGRAVARIPRVPGGGTHRAGQGAFGNMCRGGGMFNPT
KIWRRWGRKVNLKEKRYAVCSSIAASGVTSLVLARGHRISHLKEVPLVVS
NDIESLSKTKEAVNFLVSLGLKDEVNRLVKSKKIRAGKGKMRNRKYKIRN
GPLIIYENDNGVKKAFRNIPGVDLCKVTKLNLLKLAPGGSIGRLCIWSES
AFKKLDVIYGKIHEKKVTKKNYILPKSIVHNPDIYRIIHSDKVQASLLAK
KKPCKKRLQNKNSLTNFAVRCRLNPAYKLLRSLAVLRMRKSILEKSKNKK
EKRVQKQIQKKELQKINHDYYKGVAKAVKKKKKREEKKAK

3D structure

PDB

3jbn Dynamical features of the Plasmodium falciparum ribosome during translation.

Chain

Resolution

4.7 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AF	R33 Q38 T42 S45 K46 N47 R48 R49 H50 Y52 V54 K55 A58 Y60 T62 S63 G70 R71 A72 V73 A74 R75 I76 P77 R78 G83 T84 R86 Q89 G90 N94 M95 C96 R97 G98 M101 F102 N103 W108 R109 R110 R113 K114 N116 L117 K118 K120 R121 Y122 R140 R143 K163 T164 K165 R182 K187 R190 A191 G192 K193 K195 M196 R197 R199 K200 Y201 K202 R204 N205 D214 K218 K219 R222 N223 K234 P242 G243 K271 K274 K275 Y290 K305 K306 K307 P308 C309 K310 K311 R312 L313 Q314 N315 K316 N317 N321 F322 A323 C326 R327 Y332 K333 R336 S337 A339 L341 R342 R344 K345 K350 K354 K355 K357 R358 K365 N372 H373 Y376 K377 K381 K384 K385 K387 K388 K395	R28 Q33 T37 S40 K41 N42 R43 R44 H45 Y47 V49 K50 A53 Y55 T57 S58 G65 R66 A67 V68 A69 R70 I71 P72 R73 G78 T79 R81 Q84 G85 N89 M90 C91 R92 G93 M96 F97 N98 W103 R104 R105 R108 K109 N111 L112 K113 K115 R116 Y117 R135 R138 K158 T159 K160 R177 K182 R185 A186 G187 K188 K190 M191 R192 R194 K195 Y196 K197 R199 N200 D209 K213 K214 R217 N218 K229 P237 G238 K266 K269 K270 Y285 K300 K301 K302 P303 C304 K305 K306 R307 L308 Q309 N310 K311 N312 N316 F317 A318 C321 R322 Y327 K328 R331 S332 A334 L336 R337 R339 K340 K345 K349 K350 K352 R353 K360 N367 H368 Y371 K372 K376 K379 K380 K382 K383 K390
BS02	rna	AF	A53 K55 K195 M196	A48 K50 K190 M191

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:3jbn, PDBe:3jbn, PDBj:3jbn
PDBsum	3jbn
PubMed	26432834
UniProt	Q8I431

[Back to BioLiP]