Structure of PDB 9f1d Chain AE

Receptor sequence

>9f1dAE (length=101) Species: 9986 (Oryctolagus cuniculus)

TKKRRNNGRAKKGRGHVQPIRCTNCARCVPKDKAIKKFVIRNIVEAAAVR
DISEASVFDAYVLPKLYVKLHYCVSCAIHSKVVRNRSREARKDRTPPPRF
R

3D structure

• PDB: 9f1d NAC guides a ribosomal multienzyme complex for nascent protein processing.
• Chain: AE
• Resolution: 3.26 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AE	T2 K3 K4 R5 R6 N7 N8 G9 R10 A11 K12 K13 R15 G16 H17 Q19 R28 K32 K34 K37 F39 Y68 K70 V75 I79 H80 K82 V83 V84 R85 N86 R87 S88 R92 R95 P97 P98 R100	T1 K2 K3 R4 R5 N6 N7 G8 R9 A10 K11 K12 R14 G15 H16 Q18 R27 K31 K33 K36 F38 Y67 K69 V74 I78 H79 K81 V82 V83 R84 N85 R86 S87 R91 R94 P96 P97 R99
BS02	ZN	AE	C23 C77	C22 C76

External links

• PDB: RCSB:9f1d, PDBe:9f1d, PDBj:9f1d
• PDBsum: 9f1d
• PubMed: 39169182