Structure of PDB 9f1c Chain AE

Receptor sequence

>9f1cAE (length=101) Species: 9986 (Oryctolagus cuniculus)

TKKRRNNGRAKKGRGHVQPIRCTNCARCVPKDKAIKKFVIRNIVEAAAVR
DISEASVFDAYVLPKLYVKLHYCVSCAIHSKVVRNRSREARKDRTPPPRF
R

3D structure

• PDB: 9f1c NAC guides a ribosomal multienzyme complex for nascent protein processing.
• Chain: AE
• Resolution: 3.78 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AE	T2 K3 K4 R5 R6 N7 N8 R10 A11 K12 K13 G14 R15 G16 H17 R28 K32 K34 K37 K38 F39 V75 I79 K82 V84 R85 N86 R87 S88 R92 K93 R95 P97 P98 R100	T1 K2 K3 R4 R5 N6 N7 R9 A10 K11 K12 G13 R14 G15 H16 R27 K31 K33 K36 K37 F38 V74 I78 K81 V83 R84 N85 R86 S87 R91 K92 R94 P96 P97 R99
BS02	ZN	AE	C23 C26 C77	C22 C25 C76

External links

• PDB: RCSB:9f1c, PDBe:9f1c, PDBj:9f1c
• PDBsum: 9f1c
• PubMed: 39169182