Structure of PDB 8ove Chain AE

Receptor sequence

>8oveAE (length=152) Species: 5702 (Trypanosoma brucei brucei) [Search protein sequence]

YARTPTVDLTVQHEKAYQRQTAVNENIRTASKKHVNRSGHIRYSKKIGLG
FATPKAAINGKYIDRKCPFTSNVSIRGRILRGVVHSTKMRRSIVIRRNYL
HFIRKYQRYQKRHRNITVHCSPCFDPKPGDEVVVGQCRPLSKTIRYNVLQ
VV

3D structure

PDB

8ove A single pseudouridine on rRNA regulates ribosome structure and function in the mammalian parasite Trypanosoma brucei.

Chain

Resolution

2.6 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AE	T28 A29 N31 I34 K40 K53 G55 N79 I82 R83 R85 S93 K95 M96 R104 Y106 K112 Y113 K118 R119 H120 R121 N122 R145 P146 S148 K149 T150 R152	T21 A22 N24 I27 K33 K46 G48 N72 I75 R76 R78 S86 K88 M89 R97 Y99 K105 Y106 K111 R112 H113 R114 N115 R138 P139 S141 K142 T143 R145

Gene Ontology

	Molecular Function
GO:0003729	mRNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0000314	organellar small ribosomal subunit
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8ove, PDBe:8ove, PDBj:8ove
PDBsum	8ove
PubMed	37985661
UniProt	Q38CI4

[Back to BioLiP]