Structure of PDB 8ova Chain AE

Receptor sequence

>8ovaAE (length=153) Species: 5702 (Trypanosoma brucei brucei) [Search protein sequence]

NYARTPTVDLTVQHEKAYQRQTAVNENIRTASKKHVNRSGHIRYSKKIGL
GFATPKAAINGKYIDRKCPFTSNVSIRGRILRGVVHSTKMRRSIVIRRNY
LHFIRKYQRYQKRHRNITVHCSPCFDPKPGDEVVVGQCRPLSKTIRYNVL
QVV

3D structure

PDB

8ova A single pseudouridine on rRNA regulates ribosome structure and function in the mammalian parasite Trypanosoma brucei.

Chain

Resolution

2.47 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AE	A29 N31 K40 Y50 K53 G55 L56 R72 K73 S78 N79 I82 R83 R85 M96 R97 K112 Y113 K118 R119 H120 R121 N122 P146 S148 K149 T150 R152 Y153	A23 N25 K34 Y44 K47 G49 L50 R66 K67 S72 N73 I76 R77 R79 M90 R91 K106 Y107 K112 R113 H114 R115 N116 P140 S142 K143 T144 R146 Y147

Gene Ontology

	Molecular Function
GO:0003729	mRNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0000314	organellar small ribosomal subunit
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8ova, PDBe:8ova, PDBj:8ova
PDBsum	8ova
PubMed	37985661
UniProt	Q38CI4

[Back to BioLiP]