Structure of PDB 8cre Chain AE

Receptor sequence

>8creAE (length=110) Species: 5476 (Candida albicans)

ALQDVVTREYTINLHKRLHGVNFKKRAPKAVKEIKKFATLHMGTTDVRLD
PKLNIAIWKRGVQGVENRMRLRISRKRNDEEDAKEKLFAYVEPVIVPSTK
GLQTVVVEDD

3D structure

• PDB: 8cre Drug-induced rotational movement of the ribosome is a key factor for read-through enhancement
• Chain: AE
• Resolution: 3.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AE	R9 T12 N14 H16 K17 R18 H20 G21 V22 N23 F24 K25 R27 K33 F38 H42 L50 P52 N55 I56 W59 R61 G62 V63 Q64 R69 G102 L103 Q104 T105	R8 T11 N13 H15 K16 R17 H19 G20 V21 N22 F23 K24 R26 K32 F37 H41 L49 P51 N54 I55 W58 R60 G61 V62 Q63 R68 G101 L102 Q103 T104
BS02	MG	AE	E109 D110	E108 D109

External links

• PDB: RCSB:8cre, PDBe:8cre, PDBj:8cre
• PDBsum: 8cre
• UniProt: A0A8H6F1M1