Structure of PDB 7qi5 Chain AE

Receptor sequence
>7qi5AE (length=122) Species: 9606 (Homo sapiens) [Search protein sequence]
PRYELALILKAMQRPETAATLKRTIEALMDRGAIVRDLENLGERALPYRI
SAHSQQHNRGGYFLVDFYAPTAAVESMVEHLSRDIDVIRGNIVKHPLTQE
LKECEGIVPVPLAEKLYSTKKR
3D structure
PDB7qi5 Structure of mitoribosome reveals mechanism of mRNA binding, tRNA interactions with L1 stalk, roles of cofactors and rRNA modifications.
ChainAE
Resolution2.63 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna AE Y4 Y49 R50 Q57 R90 I93 V94 K95 Y118 S119 K121 Y3 Y48 R49 Q56 R89 I92 V93 K94 Y117 S118 K120
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0019843 rRNA binding
GO:0070181 small ribosomal subunit rRNA binding
Biological Process
GO:0006412 translation
GO:0032543 mitochondrial translation
Cellular Component
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005763 mitochondrial small ribosomal subunit
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7qi5, PDBe:7qi5, PDBj:7qi5
PDBsum7qi5
PubMed38769321
UniProtP82932|RT06_HUMAN Small ribosomal subunit protein bS6m (Gene Name=MRPS6)

[Back to BioLiP]