Structure of PDB 7pbw Chain AE

Receptor sequence
>7pbwAE (length=50) Species: 272943 (Cereibacter sphaeroides 2.4.1) [Search protein sequence]
MTNGKIWLVVKPTVGVPLFLSAAVIASVVIHAAVLTTTTWLPAYYQGSAA
3D structure
PDB7pbw Cryo-EM Structure of the Rhodobacter sphaeroides Light-Harvesting 2 Complex at 2.1 angstrom.
ChainAE
Resolution2.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 7OT AE N3 K5 I6 N3 K5 I6
BS02 BCL AE F19 A22 A26 F19 A22 A26
BS03 BCL AE V24 S27 H31 V34 L41 Y45 V24 S27 H31 V34 L41 Y45
BS04 BCL AE M1 N3 F19 M1 N3 F19
BS05 7OT AE H31 Y45 H31 Y45
BS06 BCL AE S27 I30 H31 S27 I30 H31
BS07 BCL AE Y44 Y45 Y44 Y45
Gene Ontology
Molecular Function
GO:0042314 bacteriochlorophyll binding
GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872 metal ion binding
Biological Process
GO:0019684 photosynthesis, light reaction
Cellular Component
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0019866 organelle inner membrane
GO:0030076 light-harvesting complex
GO:0030077 plasma membrane light-harvesting complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7pbw, PDBe:7pbw, PDBj:7pbw
PDBsum7pbw
PubMed34699186
UniProtQ3J144|LHA2_CERS4 Light-harvesting protein B-800/850 alpha chain (Gene Name=pucA)

[Back to BioLiP]